LIPF anticorps (N-Term)

N° du produit ABIN633941

L’anticorps Lapin Polyclonal anti-LIPF a été validé pour WB. Il convient pour détecter LIPF dans des échantillons de Humain.

Aperçu rapide pour LIPF anticorps (N-Term) (ABIN633941)

Antigène: LIPF (Lipase, Gastric (LIPF))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIPF est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LIPF anticorps

Épitope: N-Term

Specificité: Lipase antibody (Gastric) was raised against the N terminal of LIPF

Purification: Affinity purified

Immunogène: Lipase antibody (Gastric) was raised using the N terminal of LIPF corresponding to a region with amino acids ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Lipase Blocking Peptide (Gastric), (ABIN939549), is also available for use as a blocking control in assays to test for specificity of this Lipase antibody (Gastric)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIPF

Antigène: LIPF (Lipase, Gastric (LIPF))

Autre désignation: Gastric Lipase

Sujet: This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism.

Poids moléculaire: 43 kDa (MW of target protein)