OXCT2 anticorps (Middle Region)
-
- Antigène Voir toutes OXCT2 Anticorps
- OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OXCT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OXCT2 antibody was raised against the middle region of OXCT2
- Purification
- Affinity purified
- Immunogène
- OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV
- Top Product
- Discover our top product OXCT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OXCT2 Blocking Peptide, catalog no. 33R-3340, is also available for use as a blocking control in assays to test for specificity of this OXCT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))
- Autre désignation
- OXCT2 (OXCT2 Produits)
- Synonymes
- anticorps SCOTT, anticorps Oxct, anticorps Oxct2, anticorps Scot, anticorps Scot-t1, anticorps 3-oxoacid CoA-transferase 2, anticorps succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial, anticorps 3-oxoacid CoA transferase 2A, anticorps OXCT2, anticorps LOC100341106, anticorps Oxct2a, anticorps Oxct2
- Sujet
- OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transferof CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transfer of CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.
- Poids moléculaire
- 56 kDa (MW of target protein)
-