OXCT2 anticorps (Middle Region)

N° du produit ABIN633946

Cet anticorps Lapin Polyclonal détecte spécifiquement OXCT2 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour OXCT2 anticorps (Middle Region) (ABIN633946)

Antigène: OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OXCT2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OXCT2 anticorps

Épitope: Middle Region

Specificité: OXCT2 antibody was raised against the middle region of OXCT2

Purification: Affinity purified

Immunogène: OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OXCT2 Blocking Peptide, (ABIN938726), is also available for use as a blocking control in assays to test for specificity of this OXCT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OXCT2

Antigène: OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))

Autre désignation: OXCT2

Sujet: OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transferof CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transfer of CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.

Poids moléculaire: 56 kDa (MW of target protein)