AER61 anticorps (C-Term)

N° du produit ABIN633948

Cet anticorps anti-AER61 est un anticorps Lapin Polyclonal détectant AER61 dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour AER61 anticorps (C-Term) (ABIN633948)

Antigène: AER61 (C3orf64) (Chromosome 3 Open Reading Frame 64 (C3orf64))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AER61 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AER61 anticorps

Épitope: C-Term

Specificité: C3 ORF64 antibody was raised against the C terminal Of C3 rf64

Purification: Affinity purified

Immunogène: C3 ORF64 antibody was raised using the C terminal Of C3 rf64 corresponding to a region with amino acids GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C3ORF64 Blocking Peptide, (ABIN938694), is also available for use as a blocking control in assays to test for specificity of this C3ORF64 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF64 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AER61

Antigène: AER61 (C3orf64) (Chromosome 3 Open Reading Frame 64 (C3orf64))

Autre désignation: C3ORF64

Sujet: The function of C3orf64 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 52 kDa (MW of target protein)