AER61 anticorps (C-Term)

N° du produit ABIN633948

Détail du produit anti-AER61 anticorps

Antigène: AER61 (C3orf64) (Chromosome 3 Open Reading Frame 64 (C3orf64))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AER61 est non-conjugé

Application: Western Blotting (WB)

Specificité: C3 ORF64 antibody was raised against the C terminal Of C3 rf64

Purification: Affinity purified

Immunogène: C3 ORF64 antibody was raised using the C terminal Of C3 rf64 corresponding to a region with amino acids GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C3ORF64 Blocking Peptide, catalog no. 33R-3308, is also available for use as a blocking control in assays to test for specificity of this C3ORF64 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF64 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AER61

Antigène: AER61 (C3orf64) (Chromosome 3 Open Reading Frame 64 (C3orf64))

Autre désignation: C3ORF64 (C3orf64 Produits)

Synonymes: anticorps AER61, anticorps aer61, anticorps c3orf64, anticorps C12H3orf64, anticorps EOGT, anticorps C22H3orf64, anticorps AOS4, anticorps C3orf64, anticorps EOGT1, anticorps A130022J15Rik, anticorps AI447490, anticorps AW214473, anticorps AW259391, anticorps Aer61, anticorps EGF domain specific O-linked N-acetylglucosamine transferase, anticorps glycosyltransferase aer61, anticorps EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase, anticorps EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase L homeolog, anticorps EOGT, anticorps aer61, anticorps eogt, anticorps eogt.L, anticorps Eogt

Sujet: The function of C3orf64 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 52 kDa (MW of target protein)