WFDC5 anticorps (N-Term)

N° du produit ABIN633949

Cet anticorps Lapin Polyclonal détecte spécifiquement WFDC5 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour WFDC5 anticorps (N-Term) (ABIN633949)

Antigène: WFDC5 (WAP Four-Disulfide Core Domain 5 (WFDC5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WFDC5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-WFDC5 anticorps

Épitope: N-Term

Specificité: WFDC5 antibody was raised against the N terminal of WFDC5

Purification: Affinity purified

Immunogène: WFDC5 antibody was raised using the N terminal of WFDC5 corresponding to a region with amino acids MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WFDC5 Blocking Peptide, (ABIN5617012), is also available for use as a blocking control in assays to test for specificity of this WFDC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WFDC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WFDC5

Antigène: WFDC5 (WAP Four-Disulfide Core Domain 5 (WFDC5))

Autre désignation: WFDC5

Sujet: This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.

Poids moléculaire: 11 kDa (MW of target protein)