Plexin A4 anticorps (Middle Region)

N° du produit ABIN633960

Détail du produit anti-Plexin A4 anticorps

Antigène: Plexin A4 (PLXNA4)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Plexin A4 est non-conjugé

Application: Western Blotting (WB)

Specificité: Plexin A4 antibody was raised against the middle region of PLXNA4

Purification: Affinity purified

Immunogène: Plexin A4 antibody was raised using the middle region of PLXNA4 corresponding to a region with amino acids TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Plexin A4 Blocking Peptide, catalog no. 33R-9241, is also available for use as a blocking control in assays to test for specificity of this Plexin A4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXNA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Plexin A4

Antigène: Plexin A4 (PLXNA4)

Autre désignation: Plexin A4 (PLXNA4 Produits)

Synonymes: anticorps D204, anticorps wu:fd49b01, anticorps wu:fe15f03, anticorps PLXNA4A, anticorps FAYV2820, anticorps PLEXA4, anticorps PLXNA4B, anticorps PRO34003, anticorps 9330117B14, anticorps Plxa4, anticorps mKIAA1550, anticorps PLEX2, anticorps Plxna4, anticorps PLXNA4, anticorps plexin A4, anticorps plexin-A4, anticorps plxna4, anticorps PLXNA4, anticorps LOC100467706, anticorps Plxna4

Sujet: This protein mediates semaphorin receptor activity.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Regulation of Cell Size