ERLIN2 anticorps (Middle Region)

N° du produit ABIN633961

Cet anticorps Lapin Polyclonal détecte spécifiquement ERLIN2 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour ERLIN2 anticorps (Middle Region) (ABIN633961)

Antigène: ERLIN2 (ER Lipid Raft Associated 2 (ERLIN2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERLIN2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ERLIN2 anticorps

Épitope: Middle Region

Specificité: ERLIN2 antibody was raised against the middle region of ERLIN2

Purification: Affinity purified

Immunogène: ERLIN2 antibody was raised using the middle region of ERLIN2 corresponding to a region with amino acids ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ERLIN2 Blocking Peptide, (ABIN936904), is also available for use as a blocking control in assays to test for specificity of this ERLIN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERLIN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERLIN2

Antigène: ERLIN2 (ER Lipid Raft Associated 2 (ERLIN2))

Autre désignation: ERLIN2

Sujet: ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.

Poids moléculaire: 38 kDa (MW of target protein)