ERLIN2 anticorps (Middle Region)

N° du produit ABIN633961

Détail du produit anti-ERLIN2 anticorps

Antigène: ERLIN2 (ER Lipid Raft Associated 2 (ERLIN2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERLIN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ERLIN2 antibody was raised against the middle region of ERLIN2

Purification: Affinity purified

Immunogène: ERLIN2 antibody was raised using the middle region of ERLIN2 corresponding to a region with amino acids ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ERLIN2 Blocking Peptide, catalog no. 33R-1518, is also available for use as a blocking control in assays to test for specificity of this ERLIN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERLIN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERLIN2

Antigène: ERLIN2 (ER Lipid Raft Associated 2 (ERLIN2))

Autre désignation: ERLIN2 (ERLIN2 Produits)

Synonymes: anticorps C8orf2, anticorps Erlin-2, anticorps NET32, anticorps SPFH2, anticorps SPG18, anticorps BC036333, anticorps C87251, anticorps Spfh2, anticorps Erlin-2-B, anticorps erlin1, anticorps spfh1, anticorps spfh2, anticorps spfh2-B, anticorps RGD1309010, anticorps SPFH domain-containing protein 2-A, anticorps erlin2, anticorps erlin2-a, anticorps erlin2-b, anticorps spfh2-A, anticorps ER lipid raft associated 2, anticorps erlin-2, anticorps Erlin-2, anticorps ER lipid raft associated 2 S homeolog, anticorps ER lipid raft associated 2 L homeolog, anticorps ERLIN2, anticorps erlin2, anticorps Tsp_03442, anticorps erln2, anticorps Erlin2, anticorps erlin2.S, anticorps erlin2.L

Sujet: ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.

Poids moléculaire: 38 kDa (MW of target protein)