HMGCL anticorps
-
- Antigène Voir toutes HMGCL Anticorps
- HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HMGCL est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL
- Top Product
- Discover our top product HMGCL Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HMGCL Blocking Peptide, catalog no. 33R-4801, is also available for use as a blocking control in assays to test for specificity of this HMGCL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))
- Autre désignation
- HMGCL (HMGCL Produits)
- Synonymes
- anticorps Afu7g01720, anticorps AO090038000541, anticorps AW476067, anticorps HL, anticorps zgc:56248, anticorps 3-hydroxymethyl-3-methylglutaryl-CoA lyase S homeolog, anticorps 3-hydroxymethyl-3-methylglutaryl-CoA lyase, anticorps 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase, anticorps 3-hydroxy-3-methylglutaryl-Coenzyme A lyase, anticorps hmgcl.S, anticorps HMGCL, anticorps AFUA_7G01720, anticorps NFIA_114450, anticorps ACLA_065820, anticorps AOR_1_910074, anticorps PMAA_004600, anticorps TSTA_103060, anticorps ARB_04874, anticorps TRV_06573, anticorps Hmgcl, anticorps hmgcl
- Sujet
- The HMGCL protein belongs to the HMG-CoA lyase family. It is a mitochondrial enzyme that catalyzes the final step of leucine degradation and plays a key role in ketone body formation. Mutations in this gene are associated with HMG-CoA lyase deficiency.
- Poids moléculaire
- 36 kDa (MW of target protein)
-