ANGPTL5 anticorps (N-Term)

N° du produit ABIN633977

L’anticorps Lapin Polyclonal anti-ANGPTL5 a été validé pour WB. Il convient pour détecter ANGPTL5 dans des échantillons de Humain.

Aperçu rapide pour ANGPTL5 anticorps (N-Term) (ABIN633977)

Antigène: ANGPTL5 (Angiopoietin-Like 5 (ANGPTL5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANGPTL5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ANGPTL5 anticorps

Épitope: N-Term

Specificité: ANGPTL5 antibody was raised against the N terminal of ANGPTL5

Purification: Affinity purified

Immunogène: ANGPTL5 antibody was raised using the N terminal of ANGPTL5 corresponding to a region with amino acids ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANGPTL5 Blocking Peptide, (ABIN936898), is also available for use as a blocking control in assays to test for specificity of this ANGPTL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANGPTL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANGPTL5

Antigène: ANGPTL5 (Angiopoietin-Like 5 (ANGPTL5))

Autre désignation: ANGPTL5

Sujet: The function of ANGPTL5 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 44 kDa (MW of target protein)