LYPD6 anticorps (Middle Region)

N° du produit ABIN633991

Détail du produit anti-LYPD6 anticorps

Antigène: LYPD6 (LY6/PLAUR Domain Containing 6 (LYPD6))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYPD6 est non-conjugé

Application: Western Blotting (WB)

Specificité: LYPD6 antibody was raised against the middle region of LYPD6

Purification: Affinity purified

Immunogène: LYPD6 antibody was raised using the middle region of LYPD6 corresponding to a region with amino acids RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYPD6 Blocking Peptide, catalog no. 33R-7859, is also available for use as a blocking control in assays to test for specificity of this LYPD6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LYPD6

Antigène: LYPD6 (LY6/PLAUR Domain Containing 6 (LYPD6))

Autre désignation: LYPD6 (LYPD6 Produits)

Synonymes: anticorps zgc:101899, anticorps DKFZp459C1429, anticorps E130115E03Rik, anticorps LY6/PLAUR domain containing 6, anticorps lypd6, anticorps LYPD6, anticorps Lypd6

Sujet: LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.

Poids moléculaire: 19 kDa (MW of target protein)