Haptoglobin anticorps (Middle Region)

N° du produit ABIN633992

Détail du produit anti-Haptoglobin anticorps

Antigène: Haptoglobin (HP)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Haptoglobin est non-conjugé

Application: Western Blotting (WB)

Specificité: Haptoglobin antibody was raised against the middle region of HP

Purification: Affinity purified

Immunogène: Haptoglobin antibody was raised using the middle region of HP corresponding to a region with amino acids NANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNE

Information d'application

Indications d'application: WB: 0.0125 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Haptoglobin Blocking Peptide, catalog no. 33R-6640, is also available for use as a blocking control in assays to test for specificity of this Haptoglobin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Haptoglobin

Antigène: Haptoglobin (HP)

Autre désignation: Haptoglobin (HP Produits)

Synonymes: anticorps HP, anticorps wu:fb64e01, anticorps BP, anticorps HP2ALPHA2, anticorps HPA1S, anticorps HP-1, anticorps HPR, anticorps Zonulin, anticorps haptoglobin, anticorps haptoglobin-like, anticorps HP, anticorps hp, anticorps Hp, anticorps LOC479668, anticorps LOC101102413

Sujet: This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis