FETUB anticorps (N-Term)

N° du produit ABIN633997

Cet anticorps Lapin Polyclonal détecte spécifiquement FETUB dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour FETUB anticorps (N-Term) (ABIN633997)

Antigène: FETUB (Fetuin B (FETUB))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FETUB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FETUB anticorps

Épitope: N-Term

Specificité: FETUB antibody was raised against the N terminal of FETUB

Purification: Affinity purified

Immunogène: FETUB antibody was raised using the N terminal of FETUB corresponding to a region with amino acids GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FETUB Blocking Peptide, (ABIN938575), is also available for use as a blocking control in assays to test for specificity of this FETUB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FETUB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FETUB

Antigène: FETUB (Fetuin B (FETUB))

Autre désignation: FETUB

Sujet: The protein encoded by this gene is a member of the fetuin family, part of the cystatin superfamily of cysteine protease inhibitors. Fetuins have been implicated in several diverse functions, including osteogenesis and bone resorption.

Poids moléculaire: 42 kDa (MW of target protein)