Chymotrypsin anticorps (N-Term)

N° du produit ABIN634009

Cet anticorps Lapin Polyclonal détecte spécifiquement Chymotrypsin dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Chymotrypsin anticorps (N-Term) (ABIN634009)

Antigène: Chymotrypsin (CTRL)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Chymotrypsin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Chymotrypsin anticorps

Épitope: N-Term

Specificité: Chymotrypsin-Like antibody was raised against the N terminal of CTRL

Purification: Affinity purified

Immunogène: Chymotrypsin-Like antibody was raised using the N terminal of CTRL corresponding to a region with amino acids SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Chymotrypsin-Like Blocking Peptide, (ABIN5612884), is also available for use as a blocking control in assays to test for specificity of this Chymotrypsin-Like antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Chymotrypsin

Antigène: Chymotrypsin (CTRL)

Autre désignation: Chymotrypsin-Like

Classe de substances: Chemical

Sujet: CTRL possesses serine-type endopeptidase activity.

Poids moléculaire: 28 kDa (MW of target protein)