CPB1 anticorps

N° du produit ABIN634020

Cet anticorps anti-CPB1 Polyclonal Lapin (ABIN634020) détecte spécifiquement CPB1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour CPB1 anticorps (ABIN634020)

Antigène: CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPB1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CPB1 anticorps

Purification: Affinity purified

Immunogène: Carboxypeptidase B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carboxypeptidase B1 Blocking Peptide, (ABIN5612616), is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPB1

Antigène: CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))

Autre désignation: Carboxypeptidase B1

Sujet: Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma.

Poids moléculaire: 35 kDa (MW of target protein)