CETP anticorps (N-Term)

N° du produit ABIN634021

Cet anticorps Lapin Polyclonal détecte spécifiquement CETP dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour CETP anticorps (N-Term) (ABIN634021)

Antigène: CETP (Cholesteryl Ester Transfer Protein (CETP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CETP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CETP anticorps

Épitope: N-Term

Specificité: CETP antibody was raised against the N terminal of CETP

Purification: Affinity purified

Immunogène: CETP antibody was raised using the N terminal of CETP corresponding to a region with amino acids ALLVLNHETAKVIQTAFQRASYPDITGEKAMMLLGQVKYGLHNIQISHLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CETP Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CETP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CETP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CETP

Antigène: CETP (Cholesteryl Ester Transfer Protein (CETP))

Autre désignation: CETP

Sujet: CETP involved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol. Defects in CETP are a cause of hyperalphalipoproteinemia.

Poids moléculaire: 53 kDa (MW of target protein)