LYPD4 anticorps (N-Term)

N° du produit ABIN634028

L’anticorps Lapin Polyclonal anti-LYPD4 a été validé pour WB. Il convient pour détecter LYPD4 dans des échantillons de Humain.

Aperçu rapide pour LYPD4 anticorps (N-Term) (ABIN634028)

Antigène: LYPD4 (LY6/PLAUR Domain Containing 4 (LYPD4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYPD4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LYPD4 anticorps

Épitope: N-Term

Specificité: LYPD4 antibody was raised against the N terminal of LYPD4

Purification: Affinity purified

Immunogène: LYPD4 antibody was raised using the N terminal of LYPD4 corresponding to a region with amino acids MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYPD4 Blocking Peptide, (ABIN5614611), is also available for use as a blocking control in assays to test for specificity of this LYPD4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LYPD4

Antigène: LYPD4 (LY6/PLAUR Domain Containing 4 (LYPD4))

Autre désignation: LYPD4

Sujet: The specific function of LYPD4 is not yet known.

Poids moléculaire: 27 kDa (MW of target protein)