LYPD4 anticorps (N-Term)

N° du produit ABIN634028

Détail du produit anti-LYPD4 anticorps

Antigène: LYPD4 (LY6/PLAUR Domain Containing 4 (LYPD4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYPD4 est non-conjugé

Application: Western Blotting (WB)

Specificité: LYPD4 antibody was raised against the N terminal of LYPD4

Purification: Affinity purified

Immunogène: LYPD4 antibody was raised using the N terminal of LYPD4 corresponding to a region with amino acids MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYPD4 Blocking Peptide, catalog no. 33R-6059, is also available for use as a blocking control in assays to test for specificity of this LYPD4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LYPD4

Antigène: LYPD4 (LY6/PLAUR Domain Containing 4 (LYPD4))

Autre désignation: LYPD4 (LYPD4 Produits)

Synonymes: anticorps LYPD4, anticorps SMR, anticorps 4933400F01Rik, anticorps rCG53718, anticorps LY6/PLAUR domain containing 4, anticorps Ly6/Plaur domain containing 4, anticorps LYPD4, anticorps Lypd4

Sujet: The specific function of LYPD4 is not yet known.

Poids moléculaire: 27 kDa (MW of target protein)