RBP4 anticorps (N-Term)

N° du produit ABIN634030

Détail du produit anti-RBP4 anticorps

Antigène: RBP4 (Retinol Binding Protein 4, Plasma (RBP4))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBP4 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBP4 antibody was raised against the N terminal of RBP4

Purification: Affinity purified

Immunogène: RBP4 antibody was raised using the N terminal of RBP4 corresponding to a region with amino acids MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBP4 Blocking Peptide, catalog no. 33R-6173, is also available for use as a blocking control in assays to test for specificity of this RBP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBP4

Antigène: RBP4 (Retinol Binding Protein 4, Plasma (RBP4))

Autre désignation: RBP4 (RBP4 Produits)

Synonymes: anticorps RDCCAS, anticorps RBP, anticorps RNBP, anticorps rbp4, anticorps MGC54038, anticorps srbp, anticorps PRBP, anticorps RBPA, anticorps Rbp-4, anticorps fb23c12, anticorps rbp, anticorps wu:fb23c12, anticorps wu:fb58d04, anticorps wu:fb72b04, anticorps zgc:86911, anticorps retinol binding protein 4, anticorps renin binding protein, anticorps retinol binding protein 4 S homeolog, anticorps retinol binding protein 4 A, plasma, anticorps retinol binding protein 4, plasma, anticorps retinol binding protein 4 L homeolog, anticorps RBP4, anticorps RENBP, anticorps rbp4.S, anticorps rbp4, anticorps Rbp4, anticorps RBP4A, anticorps rbp4.L

Sujet: This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways, Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis, Production of Molecular Mediator of Immune Response