Haptoglobin anticorps (N-Term)

N° du produit ABIN634032

Cet anticorps anti-Haptoglobin est un anticorps Lapin Polyclonal détectant Haptoglobin dans WB. Adapté pour Humain.

Aperçu rapide pour Haptoglobin anticorps (N-Term) (ABIN634032)

Antigène: Haptoglobin (HP)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Haptoglobin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Haptoglobin anticorps

Épitope: N-Term

Specificité: Haptoglobin antibody was raised against the N terminal of HP

Purification: Affinity purified

Immunogène: Haptoglobin antibody was raised using the N terminal of HP corresponding to a region with amino acids MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Haptoglobin Blocking Peptide, (ABIN5613925), is also available for use as a blocking control in assays to test for specificity of this Haptoglobin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Haptoglobin

Antigène: Haptoglobin (HP)

Autre désignation: Haptoglobin

Sujet: Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis