PAPPA2 anticorps (N-Term)

N° du produit ABIN634034

L’anticorps anti-PAPPA2 Polyclonal Lapin est utilisé pour la détection de PAPPA2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour PAPPA2 anticorps (N-Term) (ABIN634034)

Antigène: PAPPA2 (Pappalysin 2 (PAPPA2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAPPA2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PAPPA2 anticorps

Épitope: N-Term

Specificité: PAPPA2 antibody was raised against the N terminal of PAPPA2

Purification: Affinity purified

Immunogène: PAPPA2 antibody was raised using the N terminal of PAPPA2 corresponding to a region with amino acids PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAPPA2 Blocking Peptide, (ABIN5615212), is also available for use as a blocking control in assays to test for specificity of this PAPPA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPPA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAPPA2

Antigène: PAPPA2 (Pappalysin 2 (PAPPA2))

Autre désignation: PAPPA2

Sujet: PAPPA2 is a metalloproteinase which specifically cleaves IGFBP-5. It shows limited proteolysis toward IGFBP-3.

Poids moléculaire: 92 kDa (MW of target protein)