TOR3A anticorps (Middle Region)

N° du produit ABIN634037

L’anticorps anti-TOR3A Polyclonal Lapin est utilisé pour la détection de TOR3A dans des échantillons de Humain et Chien. Il a été validé pour WB.

Aperçu rapide pour TOR3A anticorps (Middle Region) (ABIN634037)

Antigène: TOR3A (Torsin Family 3, Member A (TOR3A))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TOR3A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TOR3A anticorps

Épitope: Middle Region

Specificité: TOR3 A antibody was raised against the middle region of TOR3

Purification: Affinity purified

Immunogène: TOR3 A antibody was raised using the middle region of TOR3 corresponding to a region with amino acids FHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGP

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TOR3A Blocking Peptide, (ABIN938305), is also available for use as a blocking control in assays to test for specificity of this TOR3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TOR3A

Antigène: TOR3A (Torsin Family 3, Member A (TOR3A))

Autre désignation: TOR3A

Sujet: The function of TOR3A protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 46 kDa (MW of target protein)