CHAD anticorps (Middle Region)

N° du produit ABIN634043

L’anticorps anti-CHAD Polyclonal Lapin est utilisé pour la détection de CHAD dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour CHAD anticorps (Middle Region) (ABIN634043)

Antigène: CHAD (Chondroadherin (CHAD))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHAD est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHAD anticorps

Épitope: Middle Region

Specificité: Chondroadherin antibody was raised against the middle region of CHAD

Purification: Affinity purified

Immunogène: Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids LSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Chondroadherin Blocking Peptide, (ABIN5612854), is also available for use as a blocking control in assays to test for specificity of this Chondroadherin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHAD

Antigène: CHAD (Chondroadherin (CHAD))

Autre désignation: Chondroadherin

Sujet: Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. CHAD contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages.

Poids moléculaire: 38 kDa (MW of target protein)