PRSS35 anticorps (N-Term)

N° du produit ABIN634047

Détail du produit anti-PRSS35 anticorps

Antigène: PRSS35 (Protease, serine, 35 (PRSS35))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRSS35 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRSS35 antibody was raised against the N terminal of PRSS35

Purification: Affinity purified

Immunogène: PRSS35 antibody was raised using the N terminal of PRSS35 corresponding to a region with amino acids PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRSS35 Blocking Peptide, catalog no. 33R-7394, is also available for use as a blocking control in assays to test for specificity of this PRSS35 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRSS35

Antigène: PRSS35 (Protease, serine, 35 (PRSS35))

Autre désignation: PRSS35 (PRSS35 Produits)

Synonymes: anticorps zgc:91804, anticorps C6orf158, anticorps dJ223E3.1, anticorps 6030424L22Rik, anticorps P3D9, anticorps protease, serine, 35, anticorps protease, serine 35, anticorps prss35, anticorps PRSS35, anticorps Prss35

Sujet: The function of PRSS35 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 47 kDa (MW of target protein)