CREG2 anticorps (N-Term)

N° du produit ABIN634048

Détail du produit anti-CREG2 anticorps

Antigène: CREG2 (Cellular Repressor of E1A-Stimulated Genes 2 (CREG2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CREG2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CREG2 antibody was raised against the N terminal of CREG2

Purification: Affinity purified

Immunogène: CREG2 antibody was raised using the N terminal of CREG2 corresponding to a region with amino acids VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CREG2 Blocking Peptide, catalog no. 33R-9827, is also available for use as a blocking control in assays to test for specificity of this CREG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CREG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CREG2

Antigène: CREG2 (Cellular Repressor of E1A-Stimulated Genes 2 (CREG2))

Autre désignation: CREG2 (CREG2 Produits)

Synonymes: anticorps zgc:92257, anticorps A830098L22Rik, anticorps Creg2-ps1, anticorps RGD1564056, anticorps cellular repressor of E1A-stimulated genes 2, anticorps cellular repressor of E1A stimulated genes 2, anticorps creg2, anticorps CREG2, anticorps Creg2

Sujet: The function of CREG2 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 32 kDa (MW of target protein)