RANGAP1 anticorps (N-Term)

N° du produit ABIN634052

L’anticorps Lapin Polyclonal anti-RANGAP1 a été validé pour WB. Il convient pour détecter RANGAP1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour RANGAP1 anticorps (N-Term) (ABIN634052)

Antigène: RANGAP1 (Ran GTPase Activating Protein 1 (RANGAP1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RANGAP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RANGAP1 anticorps

Épitope: N-Term

Specificité: RanGAP1 antibody was raised against the N terminal of RANGAP1

Purification: Affinity purified

Immunogène: RanGAP1 antibody was raised using the N terminal of RANGAP1 corresponding to a region with amino acids MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RanGAP1 Blocking Peptide, (ABIN5615754), is also available for use as a blocking control in assays to test for specificity of this RanGAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RANGAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RANGAP1

Antigène: RANGAP1 (Ran GTPase Activating Protein 1 (RANGAP1))

Autre désignation: RanGAP1

Sujet: RanGAP1, is a homodimeric 65 kDa polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: M Phase, Protein targeting to Nucleus