VPS29 anticorps

N° du produit ABIN634054

Cet anticorps Lapin Polyclonal détecte spécifiquement VPS29 dans WB. Il présente une réactivité avec des échantillons de Humain et Souris.

Aperçu rapide pour VPS29 anticorps (ABIN634054)

Antigène: VPS29 (Vacuolar Protein Sorting 29 (VPS29))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VPS29 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-VPS29 anticorps

Purification: Affinity purified

Immunogène: VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VPS29 Blocking Peptide, (ABIN940220), is also available for use as a blocking control in assays to test for specificity of this VPS29 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VPS29

Antigène: VPS29 (Vacuolar Protein Sorting 29 (VPS29))

Autre désignation: VPS29

Sujet: This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex.

Poids moléculaire: 20 kDa (MW of target protein)