POFUT2 anticorps (N-Term)

N° du produit ABIN634059

Détail du produit anti-POFUT2 anticorps

Antigène: POFUT2 (Protein O-Fucosyltransferase 2 (POFUT2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POFUT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: POFUT2 antibody was raised against the N terminal of POFUT2

Purification: Affinity purified

Immunogène: POFUT2 antibody was raised using the N terminal of POFUT2 corresponding to a region with amino acids GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POFUT2 Blocking Peptide, catalog no. 33R-3149, is also available for use as a blocking control in assays to test for specificity of this POFUT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POFUT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POFUT2

Antigène: POFUT2 (Protein O-Fucosyltransferase 2 (POFUT2))

Autre désignation: POFUT2 (POFUT2 Produits)

Synonymes: anticorps C21orf80, anticorps FUT13, anticorps fc46a11, anticorps wu:fc46a11, anticorps zgc:194822, anticorps 2310011G23Rik, anticorps AI256847, anticorps BC003494, anticorps protein O-fucosyltransferase 2, anticorps POFUT2, anticorps pofut2, anticorps Pofut2

Sujet: POFUT2 catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats. Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor-like repeats or thrombospondin.

Poids moléculaire: 50 kDa (MW of target protein)