SEMG1 anticorps (Middle Region)

N° du produit ABIN634064

L’anticorps anti-SEMG1 Polyclonal Lapin est utilisé pour la détection de SEMG1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour SEMG1 anticorps (Middle Region) (ABIN634064)

Antigène: SEMG1 (Semenogelin I (SEMG1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SEMG1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SEMG1 anticorps

Épitope: Middle Region

Specificité: Semenogelin I antibody was raised against the middle region of SEMG1

Purification: Affinity purified

Immunogène: Semenogelin I antibody was raised using the middle region of SEMG1 corresponding to a region with amino acids KDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Semenogelin I Blocking Peptide, (ABIN939675), is also available for use as a blocking control in assays to test for specificity of this Semenogelin I antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SEMG1

Antigène: SEMG1 (Semenogelin I (SEMG1))

Autre désignation: Semenogelin I

Sujet: SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides.

Poids moléculaire: 40 kDa (MW of target protein)