RDH16 anticorps

N° du produit ABIN634066

Détail du produit anti-RDH16 anticorps

Antigène: RDH16 (Retinol Dehydrogenase 16 (All-Trans) (RDH16))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RDH16 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RDH16 Blocking Peptide, catalog no. 33R-8550, is also available for use as a blocking control in assays to test for specificity of this RDH16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RDH16

Antigène: RDH16 (Retinol Dehydrogenase 16 (All-Trans) (RDH16))

Autre désignation: RDH16 (RDH16 Produits)

Synonymes: anticorps MGC68820, anticorps CRAD, anticorps CRAD1, anticorps Rdh6, anticorps RODH-4, anticorps SDR9C8, anticorps Rdh2, anticorps RoDHII, anticorps retinol dehydrogenase 16 (all-trans) L homeolog, anticorps retinol dehydrogenase 16 (all-trans), anticorps retinol dehydrogenase 16, anticorps rdh16.L, anticorps RDH16, anticorps rdh16, anticorps Rdh16

Sujet: RDH16 is an oxidoreductase with a preference for NAD. It oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. RDH16 has higher activity towards CRBP-bound retinol than with free retinol. It also oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. RDH16 can also catalyze the reverse reaction.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis