GTSE1 anticorps (N-Term)

N° du produit ABIN634069

Détail du produit anti-GTSE1 anticorps

Antigène: GTSE1 (G-2 and S-Phase Expressed 1 (GTSE1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GTSE1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GTSE1 antibody was raised against the N terminal of GTSE1

Purification: Affinity purified

Immunogène: GTSE1 antibody was raised using the N terminal of GTSE1 corresponding to a region with amino acids NNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GTSE1 Blocking Peptide, catalog no. 33R-6810, is also available for use as a blocking control in assays to test for specificity of this GTSE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTSE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GTSE1

Antigène: GTSE1 (G-2 and S-Phase Expressed 1 (GTSE1))

Autre désignation: GTSE1 (GTSE1 Produits)

Synonymes: anticorps gtse1, anticorps MGC81588, anticorps MGC89498, anticorps GTSE1, anticorps fb70b04, anticorps fj88g09, anticorps wu:fb70b04, anticorps wu:fj88g09, anticorps wu:fy65d12, anticorps MGC114722, anticorps B99, anticorps Gtse-1, anticorps RGD1563164, anticorps G2 and S-phase expressed 1 S homeolog, anticorps G2 and S-phase expressed 1, anticorps G-2 and S-phase expressed 1, anticorps G2 and S-phase expressed 1 L homeolog, anticorps G two S phase expressed protein 1, anticorps gtse1.S, anticorps gtse1, anticorps GTSE1, anticorps gtse1.L, anticorps Gtse1

Sujet: GTSE1 is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.

Poids moléculaire: 76 kDa (MW of target protein)