-
- Antigène Voir toutes NEK3 Anticorps
- NEK3 (NIMA related kinase 3 (NEK3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NEK3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NEK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMA
- Top Product
- Discover our top product NEK3 Anticorps primaire
-
anti-NIMA related kinase 3 (NEK3) (AA 331-361) antibody
NEK3 Reactivité: Humain WB Hôte: Lapin Polyclonal RB2961 unconjugated
anti-NIMA related kinase 3 (NEK3) (AA 406-506) antibodyNEK3 Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 2F8 unconjugated
anti-NIMA related kinase 3 (NEK3) (AA 267-506) antibodyNEK3 Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-NIMA related kinase 3 (NEK3) (AA 1-506) antibodyNEK3 Reactivité: Humain WB, IF, IP Hôte: Lapin Polyclonal unconjugated
anti-NIMA related kinase 3 (NEK3) (AA 1-506) antibodyNEK3 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-NIMA related kinase 3 (NEK3) (AA 446-474), (C-Term) antibodyNEK3 Reactivité: Souris WB, IHC (p) Hôte: Lapin Polyclonal RB34647 unconjugated
anti-NIMA related kinase 3 (NEK3) (AA 108-157) antibodyNEK3 Reactivité: Humain, Boeuf (Vache), Cobaye, Cheval, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-NIMA related kinase 3 (NEK3) antibodyNEK3 Reactivité: Humain WB, IF, IC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NEK3 Blocking Peptide, catalog no. 33R-3099, is also available for use as a blocking control in assays to test for specificity of this NEK3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NEK3 (NIMA related kinase 3 (NEK3))
- Autre désignation
- NEK3 (NEK3 Produits)
- Synonymes
- anticorps HSPK36, anticorps ATNEK3, anticorps NIMA-RELATED KINASE3, anticorps NIMA-related kinase 3, anticorps T8M17.60, anticorps T8M17_60, anticorps NIMA related kinase 3, anticorps NIMA (never in mitosis gene a)-related expressed kinase 3, anticorps NIMA-related kinase 3 S homeolog, anticorps NIMA-related kinase 3, anticorps NEK3, anticorps Nek3, anticorps nek3.S
- Sujet
- NEK3 is a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. It differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase.
- Poids moléculaire
- 58 kDa (MW of target protein)
-
Vous êtes ici:
