SMC4 anticorps (Middle Region)

N° du produit ABIN634091

L’anticorps Lapin Polyclonal anti-SMC4 a été validé pour WB. Il convient pour détecter SMC4 dans des échantillons de Humain et Rat.

Aperçu rapide pour SMC4 anticorps (Middle Region) (ABIN634091)

Antigène: SMC4 (Structural Maintenance of Chromosomes 4 (SMC4))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMC4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SMC4 anticorps

Épitope: Middle Region

Specificité: SMC4 antibody was raised against the middle region of SMC4

Purification: Affinity purified

Immunogène: SMC4 antibody was raised using the middle region of SMC4 corresponding to a region with amino acids EARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSFRQAYEDLRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMC4 Blocking Peptide, (ABIN937666), is also available for use as a blocking control in assays to test for specificity of this SMC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMC4

Antigène: SMC4 (Structural Maintenance of Chromosomes 4 (SMC4))

Autre désignation: SMC4

Sujet: SMC4 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

Poids moléculaire: 147 kDa (MW of target protein)