SMC4 anticorps (Middle Region)

N° du produit ABIN634091

Détail du produit anti-SMC4 anticorps

Antigène: SMC4 (Structural Maintenance of Chromosomes 4 (SMC4))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMC4 est non-conjugé

Application: Western Blotting (WB)

Specificité: SMC4 antibody was raised against the middle region of SMC4

Purification: Affinity purified

Immunogène: SMC4 antibody was raised using the middle region of SMC4 corresponding to a region with amino acids EARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSFRQAYEDLRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMC4 Blocking Peptide, catalog no. 33R-2280, is also available for use as a blocking control in assays to test for specificity of this SMC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMC4

Antigène: SMC4 (Structural Maintenance of Chromosomes 4 (SMC4))

Autre désignation: SMC4 (SMC4 Produits)

Synonymes: anticorps CAP-C, anticorps CAPC, anticorps SMC-4, anticorps SMC4L1, anticorps hCAP-C, anticorps 2500002A22Rik, anticorps C79747, anticorps Smc4l1, anticorps cb788, anticorps chunp6901, anticorps fb99b10, anticorps smc4l1, anticorps wu:fb99b10, anticorps xcap-c, anticorps ARABIDOPSIS THALIANA CHROMOSOME ASSOCIATED PROTEIN-C, anticorps ARABIDOPSIS THALIANA STRUCTURAL MAINTENANCE OF CHROMOSOME 4, anticorps ATCAP-C, anticorps ATSMC3, anticorps ATSMC4, anticorps K15N18.7, anticorps K15N18_7, anticorps STRUCTURAL MAINTENANCE OF CHROMOSOMES 3, anticorps structural maintenance of chromosome 3, anticorps Structural maintenance of chromosomes protein 4, anticorps structural maintenance of chromosomes 4, anticorps structural maintenance of chromosomes 4 L homeolog, anticorps structural maintenance of chromosome 3, anticorps smc-4, anticorps SMC4, anticorps Smc4, anticorps smc4, anticorps smc4.L, anticorps SMC3

Sujet: SMC4 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

Poids moléculaire: 147 kDa (MW of target protein)