RAN anticorps (Middle Region)

N° du produit ABIN634102

Cet anticorps Lapin Polyclonal détecte spécifiquement RAN dans WB. Il présente une réactivité envers Humain, Souris, Rat, Chien, Drosophila melanogaster et C. elegans.

Aperçu rapide pour RAN anticorps (Middle Region) (ABIN634102)

Antigène: RAN (RAN, Member RAS Oncogene Family (RAN))

Reactivité: Humain, Souris, Rat, Chien, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAN est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAN anticorps

Épitope: Middle Region

Specificité: Ran antibody was raised against the middle region of RAN

Purification: Affinity purified

Immunogène: Ran antibody was raised using the middle region of RAN corresponding to a region with amino acids NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ran Blocking Peptide, (ABIN5615752), is also available for use as a blocking control in assays to test for specificity of this Ran antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAN

Antigène: RAN (RAN, Member RAS Oncogene Family (RAN))

Autre désignation: Ran

Sujet: RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways, Intracellular Steroid Hormone Receptor Signaling Pathway, Protein targeting to Nucleus