Septin 12 anticorps (Middle Region)

N° du produit ABIN634113

Détail du produit anti-Septin 12 anticorps

Antigène: Septin 12 (Sep12)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Septin 12 est non-conjugé

Application: Western Blotting (WB)

Specificité: Septin 12 antibody was raised against the middle region of 40433

Purification: Affinity purified

Immunogène: Septin 12 antibody was raised using the middle region of 40433 corresponding to a region with amino acids LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Septin 12 Blocking Peptide, catalog no. 33R-5333, is also available for use as a blocking control in assays to test for specificity of this Septin 12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 41153 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Septin 12

Antigène: Septin 12 (Sep12)

Autre désignation: Septin 12 (Sep12 Produits)

Synonymes: anticorps MGC68931, anticorps fe23c11, anticorps si:dkey-23a11.2, anticorps wu:fe23c11, anticorps SPGF10, anticorps 1700028G04Rik, anticorps 4933413B09Rik, anticorps Septin12, anticorps septin 12 S homeolog, anticorps septin 12, anticorps sept12.S, anticorps SEPT12, anticorps sept12, anticorps Sept12

Sujet: Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins. They are involved in membrane dynamics, vesicle trafficking, apoptosis, and cytoskeleton remodeling, as well as infection, neurodegeneration, and neoplasia.Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins.

Poids moléculaire: 41 kDa (MW of target protein)