KIF23 anticorps (N-Term)

N° du produit ABIN634117

Détail du produit anti-KIF23 anticorps

Antigène: KIF23 (Kinesin Family Member 23 (KIF23))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF23 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF23 antibody was raised against the N terminal of KIF23

Purification: Affinity purified

Immunogène: KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids VRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGT

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF23 Blocking Peptide, catalog no. 33R-9781, is also available for use as a blocking control in assays to test for specificity of this KIF23 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF23

Antigène: KIF23 (Kinesin Family Member 23 (KIF23))

Autre désignation: KIF23 (KIF23 Produits)

Synonymes: anticorps KIF23, anticorps CHO1, anticorps KNSL5, anticorps MKLP-1, anticorps MKLP1, anticorps 3110001D19Rik, anticorps C87313, anticorps Knsl5, anticorps cb738, anticorps knsl5, anticorps mklp1, anticorps wu:fi30e02, anticorps wu:fi39f08, anticorps zMKLP1, anticorps cho1, anticorps mklp-1, anticorps kinesin family member 23, anticorps kinesin family member 23 S homeolog, anticorps KIF23, anticorps kif23, anticorps Kif23, anticorps kif23.S

Sujet: KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.

Poids moléculaire: 98 kDa (MW of target protein)