MCM9 anticorps (N-Term)

N° du produit ABIN634125

Détail du produit anti-MCM9 anticorps

Antigène: MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCM9 est non-conjugé

Application: Western Blotting (WB)

Specificité: MCM9 antibody was raised against the N terminal of MCM9

Purification: Affinity purified

Immunogène: MCM9 antibody was raised using the N terminal of MCM9 corresponding to a region with amino acids NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MCM9 Blocking Peptide, catalog no. 33R-6870, is also available for use as a blocking control in assays to test for specificity of this MCM9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCM9

Antigène: MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))

Autre désignation: MCM9 (MCM9 Produits)

Synonymes: anticorps C6orf61, anticorps MCMDC1, anticorps dJ329L24.1, anticorps dJ329L24.3, anticorps 9030408O17Rik, anticorps Gm235, anticorps Mcmdc1, anticorps RGD1560557, anticorps mcm9, anticorps minichromosome maintenance 9 homologous recombination repair factor, anticorps minichromosome maintenance 9 homologous recombination repair factor L homeolog, anticorps MCM9, anticorps Mcm9, anticorps mcm9.L

Sujet: MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.

Poids moléculaire: 44 kDa (MW of target protein)