NCAPH anticorps (C-Term)
-
- Antigène Voir toutes NCAPH Anticorps
- NCAPH (Non-SMC Condensin I Complex, Subunit H (NCAPH))
-
Épitope
- C-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NCAPH est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NCAPH antibody was raised against the C terminal of NCAPH
- Purification
- Affinity purified
- Immunogène
- NCAPH antibody was raised using the C terminal of NCAPH corresponding to a region with amino acids TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG
- Top Product
- Discover our top product NCAPH Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NCAPH Blocking Peptide, catalog no. 33R-9135, is also available for use as a blocking control in assays to test for specificity of this NCAPH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NCAPH (Non-SMC Condensin I Complex, Subunit H (NCAPH))
- Autre désignation
- NCAPH (NCAPH Produits)
- Synonymes
- anticorps NCAPH, anticorps si:dkeyp-86b9.4, anticorps zgc:158618, anticorps BRRN1, anticorps CAP-H, anticorps brrn1, anticorps cap-h, anticorps A730011O11Rik, anticorps Brrn1, anticorps HCAP-H, anticorps mKIAA0074, anticorps non-SMC condensin I complex subunit H, anticorps non-SMC condensin I complex, subunit H, anticorps condensin complex subunit 2, anticorps non-SMC condensin I complex subunit H S homeolog, anticorps NCAPH, anticorps ncaph, anticorps LOC708975, anticorps ncaph.S, anticorps Ncaph
- Sujet
- NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.
- Poids moléculaire
- 82 kDa (MW of target protein)
-