BCAT1 anticorps (N-Term)

N° du produit ABIN634139

L’anticorps anti-BCAT1 Polyclonal Lapin est utilisé pour la détection de BCAT1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour BCAT1 anticorps (N-Term) (ABIN634139)

Antigène: BCAT1 (Branched Chain Amino-Acid Transaminase 1, Cytosolic (BCAT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BCAT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BCAT1 anticorps

Épitope: N-Term

Specificité: BCAT1 antibody was raised against the N terminal of BCAT1

Purification: Affinity purified

Immunogène: BCAT1 antibody was raised using the N terminal of BCAT1 corresponding to a region with amino acids MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BCAT1 Blocking Peptide, (ABIN5612292), is also available for use as a blocking control in assays to test for specificity of this BCAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BCAT1

Antigène: BCAT1 (Branched Chain Amino-Acid Transaminase 1, Cytosolic (BCAT1))

Autre désignation: BCAT1

Sujet: This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth.

Poids moléculaire: 43 kDa (MW of target protein)