Septin 11 anticorps (N-Term)

N° du produit ABIN634141

Détail du produit anti-Septin 11 anticorps

Antigène: Septin 11 (SEPT11)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Septin 11 est non-conjugé

Application: Western Blotting (WB)

Specificité: Septin 11 antibody was raised against the N terminal of 40432

Purification: Affinity purified

Immunogène: Septin 11 antibody was raised using the N terminal of 40432 corresponding to a region with amino acids MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Septin 11 Blocking Peptide, catalog no. 33R-5793, is also available for use as a blocking control in assays to test for specificity of this Septin 11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40787 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Septin 11

Antigène: Septin 11 (SEPT11)

Autre désignation: Septin 11 (SEPT11 Produits)

Synonymes: anticorps 6230410I01Rik, anticorps AW548875, anticorps D5Ertd606e, anticorps Sept6, anticorps Sep-11, anticorps MGC81799, anticorps SEPT11, anticorps Septin-11, anticorps septin 11, anticorps septin 11 S homeolog, anticorps SEPT11, anticorps Sept11, anticorps sept11.S

Sujet: SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking.

Poids moléculaire: 49 kDa (MW of target protein)