PBK anticorps (N-Term)

N° du produit ABIN634145

L’anticorps anti-PBK Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de PBK dans des échantillons provenant de Humain, Souris et Rat. }

Aperçu rapide pour PBK anticorps (N-Term) (ABIN634145)

Antigène: PBK (PDZ Binding Kinase (PBK))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PBK est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PBK anticorps

Épitope: N-Term

Specificité: PBK antibody was raised against the N terminal of PBK

Purification: Affinity purified

Immunogène: PBK antibody was raised using the N terminal of PBK corresponding to a region with amino acids SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PBK Blocking Peptide, (ABIN5615228), is also available for use as a blocking control in assays to test for specificity of this PBK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PBK

Antigène: PBK (PDZ Binding Kinase (PBK))

Autre désignation: PBK

Sujet: PBK is a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis.

Poids moléculaire: 36 kDa (MW of target protein)