RPA4 anticorps (Middle Region)

N° du produit ABIN634150

Détail du produit anti-RPA4 anticorps

Antigène: RPA4 (Replication Protein A4, 30kDa (RPA4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPA4 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPA4 antibody was raised against the middle region of RPA4

Purification: Affinity purified

Immunogène: RPA4 antibody was raised using the middle region of RPA4 corresponding to a region with amino acids VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPA4 Blocking Peptide, catalog no. 33R-9743, is also available for use as a blocking control in assays to test for specificity of this RPA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPA4

Antigène: RPA4 (Replication Protein A4, 30kDa (RPA4))

Autre désignation: RPA4 (RPA4 Produits)

Synonymes: anticorps HSU24186, anticorps replication protein A4, anticorps RPA4

Sujet: Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32 kDa subunit of the RPA, which associates with the 70- and 13 kDa subunits to form a trimeric RPA complex. Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication