MSH5 anticorps

N° du produit ABIN634152

Cet anticorps anti-MSH5 est un anticorps Lapin Polyclonal détectant MSH5 dans WB. Adapté pour Humain et Rat.

Aperçu rapide pour MSH5 anticorps (ABIN634152)

Antigène: MSH5 (MutS Homolog 5 (MSH5))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MSH5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MSH5 anticorps

Purification: Affinity purified

Immunogène: MSH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MSH5 Blocking Peptide, (ABIN937301), is also available for use as a blocking control in assays to test for specificity of this MSH5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MSH5

Antigène: MSH5 (MutS Homolog 5 (MSH5))

Autre désignation: MSH5

Sujet: MSH5 is a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4.

Poids moléculaire: 93 kDa (MW of target protein)

Pathways: M Phase