MSH5 anticorps

N° du produit ABIN634152

Détail du produit anti-MSH5 anticorps

Antigène: MSH5 (MutS Homolog 5 (MSH5))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MSH5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MSH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MSH5 Blocking Peptide, catalog no. 33R-1915, is also available for use as a blocking control in assays to test for specificity of this MSH5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MSH5

Antigène: MSH5 (MutS Homolog 5 (MSH5))

Autre désignation: MSH5 (MSH5 Produits)

Synonymes: anticorps MSH5, anticorps G7, anticorps MUTSH5, anticorps NG23, anticorps Mut5, anticorps mutS homolog 5, anticorps mutS protein homolog 5, anticorps MSH (MutS Homolog) family, anticorps MSH5, anticorps msh5, anticorps LOC100635155, anticorps Msh5, anticorps msh-5

Sujet: MSH5 is a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4.

Poids moléculaire: 93 kDa (MW of target protein)

Pathways: M Phase