KIF9 anticorps (N-Term)

N° du produit ABIN634155

Détail du produit anti-KIF9 anticorps

Antigène: KIF9 (Kinesin Family Member 9 (KIF9))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF9 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF9 antibody was raised against the n terminal of KIF9

Purification: Affinity purified

Immunogène: KIF9 antibody was raised using the N terminal of KIF9 corresponding to a region with amino acids MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF9 Blocking Peptide, catalog no. 33R-6083, is also available for use as a blocking control in assays to test for specificity of this KIF9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF9

Antigène: KIF9 (Kinesin Family Member 9 (KIF9))

Autre désignation: KIF9 (KIF9 Produits)

Synonymes: anticorps RGD1565187, anticorps si:dkey-86l18.8, anticorps kinesin family member 9, anticorps si:dkey-86l18.8, anticorps KIF9, anticorps Kif9

Sujet: KIF9 acts as a regulator of podosomes and of podosomal matrix degradation in primary human macrophages.

Poids moléculaire: 90 kDa (MW of target protein)