KIF19 anticorps (N-Term)

N° du produit ABIN634163

Détail du produit anti-KIF19 anticorps

Antigène: KIF19 (Kinesin Family Member 19 (KIF19))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF19 est non-conjugé

Application: Western Blotting (WB)

Specificité: FLJ37300 antibody was raised against the N terminal Of Flj37300

Purification: Affinity purified

Immunogène: FLJ37300 antibody was raised using the N terminal Of Flj37300 corresponding to a region with amino acids EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE

Information d'application

Indications d'application: WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLJ37300 Blocking Peptide, catalog no. 33R-2807, is also available for use as a blocking control in assays to test for specificity of this FLJ37300 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ37300 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF19

Antigène: KIF19 (Kinesin Family Member 19 (KIF19))

Autre désignation: FLJ37300 (KIF19 Produits)

Synonymes: anticorps KIF19A, anticorps flj37300-a, anticorps Kif19a, anticorps RGD1559936, anticorps Kif19, anticorps kinesin family member 19, anticorps kinesin family member 19 S homeolog, anticorps kinesin family member 19A, anticorps KIF19, anticorps kif19, anticorps kif19.S, anticorps Kif19, anticorps Kif19a

Sujet: FLJ37300 is a hypothetical protein found on chromosome 17.

Poids moléculaire: 62 kDa (MW of target protein)