KIF5B anticorps (N-Term)

N° du produit ABIN634172

L’anticorps Lapin Polyclonal anti-KIF5B a été validé pour WB et IHC. Il convient pour détecter KIF5B dans des échantillons de Humain.

Aperçu rapide pour KIF5B anticorps (N-Term) (ABIN634172)

Antigène: KIF5B (Kinesin Family Member 5B (KIF5B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF5B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-KIF5B anticorps

Épitope: N-Term

Specificité: KIF5 B antibody was raised against the N terminal of KIF5

Purification: Affinity purified

Immunogène: KIF5 B antibody was raised using the N terminal of KIF5 corresponding to a region with amino acids CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF5B Blocking Peptide, (ABIN937139), is also available for use as a blocking control in assays to test for specificity of this KIF5B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF5B

Antigène: KIF5B (Kinesin Family Member 5B (KIF5B))

Autre désignation: KIF5B

Sujet: Kinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.

Poids moléculaire: 110 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Ribonucleoprotein Complex Subunit Organization