KIFC3 anticorps (C-Term)

N° du produit ABIN634173

Cet anticorps anti-KIFC3 est un anticorps Lapin Polyclonal détectant KIFC3 dans WB. Adapté pour Humain.

Aperçu rapide pour KIFC3 anticorps (C-Term) (ABIN634173)

Antigène: KIFC3 (Kinesin Family Member C3 (KIFC3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIFC3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KIFC3 anticorps

Épitope: C-Term

Specificité: KIFC3 antibody was raised against the C terminal of KIFC3

Purification: Affinity purified

Immunogène: KIFC3 antibody was raised using the C terminal of KIFC3 corresponding to a region with amino acids EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIFC3 Blocking Peptide, (ABIN937838), is also available for use as a blocking control in assays to test for specificity of this KIFC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIFC3

Antigène: KIFC3 (Kinesin Family Member C3 (KIFC3))

Autre désignation: KIFC3

Sujet: KIFC3 belongs to the kinesin-like protein family. It contains 1 kinesin-motor domain. KIFC3 is the minus-end microtubule-dependent motor protein. It is involved in apically targeted transport.

Poids moléculaire: 93 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization