KIFC3 anticorps (C-Term)
-
- Antigène Voir toutes KIFC3 Anticorps
- KIFC3 (Kinesin Family Member C3 (KIFC3))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KIFC3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KIFC3 antibody was raised against the C terminal of KIFC3
- Purification
- Affinity purified
- Immunogène
- KIFC3 antibody was raised using the C terminal of KIFC3 corresponding to a region with amino acids EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV
- Top Product
- Discover our top product KIFC3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIFC3 Blocking Peptide, catalog no. 33R-2452, is also available for use as a blocking control in assays to test for specificity of this KIFC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KIFC3 (Kinesin Family Member C3 (KIFC3))
- Autre désignation
- KIFC3 (KIFC3 Produits)
- Synonymes
- anticorps fc51b05, anticorps si:ch211-160j6.2, anticorps wu:fc51b05, anticorps AI325457, anticorps BB123200, anticorps KRP4, anticorps kinesin family member C3, anticorps kifc3, anticorps KIFC3, anticorps Kifc3
- Sujet
- KIFC3 belongs to the kinesin-like protein family. It contains 1 kinesin-motor domain. KIFC3 is the minus-end microtubule-dependent motor protein. It is involved in apically targeted transport.
- Poids moléculaire
- 93 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-